PDB entry 1wjs

View 1wjs on RCSB PDB site
Description: Solution structure of the first mbt domain from human KIAA1798 protein
Class: protein binding
Keywords: mbt domain, KIAA1798, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1798 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA fj20547
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96JM7 (7-120)
    • cloning artifact (0-6)
    • cloning artifact (121-126)
  Domains in SCOPe 2.08: d1wjsa1, d1wjsa2, d1wjsa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjsA (A:)
  gssgssgpynkngfkvgmklegvdpehqsvycvltvaevcgyriklhfdgysdcydfwvn
  adaldihpvgwcektghklhppkgykeeefnwqtylktckaqaapkslfenqnitvipsg
  fsgpssg