PDB entry 1wjp

View 1wjp on RCSB PDB site
Description: solution structure of zf-c2h2 domains from human zinc finger protein 295
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-29, with a file datestamp of 2004-11-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjpA (A:)
    gssgssgaspvenkevyqcrlcnaklsslleqgsherlcrnaavcpycslrffspelkqe
    heskceykkltclecmrtfkssfsiwrhqvevhnqnnmaptsgpssg