PDB entry 1wjo

View 1wjo on RCSB PDB site
Description: solution structure of the forth ch domain from human plastin 3 t- isoform
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-29, with a file datestamp of 2004-11-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wjoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wjoA (A:)
gssgssgnddiivnwvnrtlseagkstsiqsfkdktissslavvdlidaiqpgcinydlv
ksgnlteddkhnnakyavsmarrigarvyalpedlvevkpkmvmtvfaclmgrgmkrvsg
pssg