PDB entry 1wjo

View 1wjo on RCSB PDB site
Description: Solution structure of the forth CH domain from human plastin 3 T-isoform
Class: protein binding
Keywords: CH domain, actin binding, plastin 3, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-plastin
    Species: Homo sapiens [TaxId:9606]
    Gene: IMS cDNA HEP01557
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13797 (7-117)
      • cloning artifact (0-6)
      • cloning artifact (118-123)
    Domains in SCOPe 2.08: d1wjoa1, d1wjoa2, d1wjoa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjoA (A:)
    gssgssgnddiivnwvnrtlseagkstsiqsfkdktissslavvdlidaiqpgcinydlv
    ksgnlteddkhnnakyavsmarrigarvyalpedlvevkpkmvmtvfaclmgrgmkrvsg
    pssg