PDB entry 1wjn

View 1wjn on RCSB PDB site
Description: Solution structure of the C-terminal ubiquitin-like domain of mouse tubulin-specific chaperone e
Class: chaperone
Keywords: ubiquitin-like domain, progressive motor neuropathy, tubulin-folding protein TBCE, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CHAPERONE
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin-folding protein TBCE
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2610206D02
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CIV8 (7-90)
      • cloning artifact (0-6)
      • cloning artifact (91-96)
    Domains in SCOPe 2.07: d1wjna1, d1wjna2, d1wjna3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjnA (A:)
    gssgssgqlltlkikcsnqperqilekqlpdsmtvqkvkgllsrllkvpvselllsyess
    kmpgreielendlqplqfysvengdcllvrwsgpssg