PDB entry 1wjm

View 1wjm on RCSB PDB site
Description: Solution structure of pleckstrin homology domain of human beta III spectrin.
Class: signaling protein
Keywords: PH domain, signal transduction, structural genomics, Spectrin beta chain, brain 2, KIAA0302, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-spectrin III
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hf00409
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15020 (7-116)
    • cloning artifact (0-6)
    • cloning artifact (117-122)
  Domains in SCOPe 2.08: d1wjma1, d1wjma2, d1wjma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjmA (A:)
  gssgssgeqmegmlcrkqemeafgkkaanrswqnvycvlrrgslgfykdakaasagvpyh
  gevpvslaraqgsvafdyrkrkhvfklglqdgkeylfqakdeaemsswlrvvnaaiasgp
  ssg