PDB entry 1wjl

View 1wjl on RCSB PDB site
Description: Solution structure of PDZ domain of mouse Cypher protein
Class: protein binding
Keywords: PDZ domain, signal transduction, a striated muscle-specific PDZLIM domain, LIM domain binding 3, ZASP, Z-band alternatively spliced PDZ-motif protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cypher protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1110032B18
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D130 (7-89)
    • cloning artifact (0-6)
  Domains in SCOPe 2.08: d1wjla1, d1wjla2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjlA (A:)
  gssgssgmsysvtltgpgpwgfrlqggkdfnmpltisritpgskaaqsqlsqgdlvvaid
  gvntdtmthleaqnkiksasynlsltlqks