PDB entry 1wjk

View 1wjk on RCSB PDB site
Description: Solution structure of hypothetical protein C330018D20Rik from Mus musculus
Class: structural genomics, unknown function
Keywords: glutaredoxin, thioredoxin fold, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-29, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: C330018D20rik protein
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA C330018D20
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9CWB7 (7-93)
    • cloning artifact (0-6)
    • cloning artifact (94-99)
  Domains in SCOP 1.73: d1wjka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjkA (A:)
  gssgssgnlsasnralpvltlftkapcplcdeakevlqpykdrfilqevditlpenstwy
  erykfdipvfhlngqflmmhrvntsklekqlrklsgpssg