PDB entry 1wjk

View 1wjk on RCSB PDB site
Description: Solution structure of hypothetical protein C330018D20Rik from Mus musculus
Class: structural genomics, unknown function
Keywords: glutaredoxin, thioredoxin fold, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C330018D20rik protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA C330018D20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CWB7 (7-93)
      • cloning artifact (0-6)
      • cloning artifact (94-99)
    Domains in SCOPe 2.08: d1wjka1, d1wjka2, d1wjka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjkA (A:)
    gssgssgnlsasnralpvltlftkapcplcdeakevlqpykdrfilqevditlpenstwy
    erykfdipvfhlngqflmmhrvntsklekqlrklsgpssg