PDB entry 1wji

View 1wji on RCSB PDB site
Description: solution structure of the uba domain of human tudor domain containing protein 3
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-29, with a file datestamp of 2004-11-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wjia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjiA (A:)
    gssgssgvdekalkhitemgfskeasrqalmdngnnleaalnvlltsnkqkpvmgppsgp
    ssg