PDB entry 1wji

View 1wji on RCSB PDB site
Description: Solution Structure of the UBA Domain of Human Tudor Domain Containing Protein 3
Class: structural genomics, unknown function
Keywords: UBA domain, tudor domain containing 3, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor domain containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IMS cDNA CAE03871
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7E2 (7-56)
      • cloning artifact (0-6)
      • cloning artifact (57-62)
    Domains in SCOPe 2.07: d1wjia1, d1wjia2, d1wjia3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjiA (A:)
    gssgssgvdekalkhitemgfskeasrqalmdngnnleaalnvlltsnkqkpvmgppsgp
    ssg