PDB entry 1wjh

View 1wjh on RCSB PDB site
Description: Solution Structure of the Homeobox Domain of Human Homeodomain Leucine Zipper-Encoding Gene (Homez)
Class: DNA binding protein
Keywords: homeobox domain, homeodomain leucine zipper-encoding gene, Homez, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-02-27, with a file datestamp of 2007-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox-leucine zipper protein Homez
    Species: HOMO SAPIENS
    Gene: KAZUSA cDNA hj01820b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IX15 (7-69)
      • cloning artifact (0-6)
      • cloning artifact (70-75)
    Domains in SCOPe 2.07: d1wjha1, d1wjha2, d1wjha3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjhA (A:)
    gssgssgkrktkeqlailksfflqcqwarredyqkleqitglprpeiiqwfgdtryalkh
    gqlkwfrdnasgpssg