SCOPe 2.06: Structural Classification of Proteins

PDB entry 1wjg

View 1wjg on RCSB PDB site
Description: Crystal structure of a probable ATP binding protein from thermus themophilus HB8
Class: protein binding
Keywords: ATP BINDING PROTEIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, PROTEIN BINDING
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: probable ATP binding protein
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SJV7
Domains in SCOPe 2.06: d1wjga_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1wjgA (A:)
mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrle
raegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgs
qsqrvvaeapcpvllvr

Sequence, based on observed residues (ATOM records): (download)

>1wjgA (A:)
fktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrler
aegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsq
sqrvvaeapcpvllv