PDB entry 1wjf

View 1wjf on RCSB PDB site
Description: solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, 40 structures
Class: zn-binding protein
Keywords: zn-binding protein, aids, polyprotein, hydrolase, aspartyl protease
Deposited on 1998-06-11, released 1998-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-54)
      • engineered mutation (11)
    Domains in SCOPe 2.08: d1wjfa_
  • Chain 'B':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-54)
      • engineered mutation (11)
    Domains in SCOPe 2.08: d1wjfb_
  • Heterogens: CD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjfA (A:)
    fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjfB (B:)
    fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd