PDB entry 1wje

View 1wje on RCSB PDB site
Description: solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure
Class: zn-binding protein
Keywords: zn-binding protein, aids, polyprotein, hydrolase, aspartyl protease
Deposited on 1998-06-11, released 1998-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 integrase
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-45)
    • engineered mutation (11)
  Domains in SCOPe 2.08: d1wjea_
• Chain 'B':
  Compound: hiv-1 integrase
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-45)
    • engineered mutation (11)
  Domains in SCOPe 2.08: d1wjeb_
• Heterogens: CD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjeA (A:)
  fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjeB (B:)
  fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlk