PDB entry 1wje

View 1wje on RCSB PDB site
Description: solution structure of h12c mutant of the n-terminal zn binding domain of hiv-1 integrase complexed to cadmium, nmr, minimized average structure
Class: zn-binding protein
Keywords: zn-binding protein, aids, polyprotein, hydrolase, aspartyl protease
Deposited on 1998-06-11, released 1998-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-45)
      • mutation (11)
    Domains in SCOPe 2.07: d1wjea_
  • Chain 'B':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-45)
      • mutation (11)
    Domains in SCOPe 2.07: d1wjeb_
  • Heterogens: CD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjeA (A:)
    fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wjeB (B:)
    fldgidkaqeecekyhsnwramasdfnlppvvakeivascdkcqlk