PDB entry 1wjd

View 1wjd on RCSB PDB site
Description: solution structure of the n-terminal zn binding domain of hiv-1 integrase (e form), nmr, 38 structures
Class: zn-binding protein
Keywords: zn-binding protein, aids, polyprotein, hydrolase, aspartyl protease, endonuclease
Deposited on 1997-05-13, released 1998-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 integrase
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497 (0-54)
  Domains in SCOPe 2.08: d1wjda_
• Chain 'B':
  Compound: hiv-1 integrase
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497 (0-54)
  Domains in SCOPe 2.08: d1wjdb_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjdA (A:)
  fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjdB (B:)
  fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd