PDB entry 1wjc

View 1wjc on RCSB PDB site
Description: solution structure of the n-terminal zn binding domain of hiv-1 integrase (e form), nmr, regularized mean structure
Deposited on 1997-05-13, released 1998-05-13
The last revision prior to the SCOP 1.71 freeze date was dated 1998-05-13, with a file datestamp of 1998-05-13.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wjca_
  • Chain 'B':
    Domains in SCOP 1.71: d1wjcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wjcA (A:)
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wjcB (B:)
fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkg