PDB entry 1wjb

View 1wjb on RCSB PDB site
Description: solution structure of the n-terminal zn binding domain of hiv-1 integrase (d form), nmr, 40 structures
Class: zn-binding protein
Keywords: zn-binding protein, aids, polyprotein, hydrolase, aspartyl protease, endonuclease
Deposited on 1997-05-13, released 1998-05-13
The last revision prior to the SCOP 1.75 freeze date was dated 1998-05-13, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 integrase
  Species: Human immunodeficiency virus 1
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497 (0-54)
  Domains in SCOP 1.75: d1wjba_
• Chain 'B':
  Compound: hiv-1 integrase
  Species: Human immunodeficiency virus 1
  Gene: POTENTIAL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497 (0-54)
  Domains in SCOP 1.75: d1wjbb_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjbA (A:)
  fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wjbB (B:)
  fldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvd