PDB entry 1wj9

View 1wj9 on RCSB PDB site
Description: Crystal structure of a CRISPR-associated protein from thermus thermophilus
Class: Structural genomics, unknown function
Keywords: ALPHA AND BETA PROTEIN, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRISPR-associated protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wj9a1, d1wj9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wj9A (A:)
    mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
    vqtltepdwsvldegyaqvfppkpfhpalkpgqrlrfrlranpakrlaatgkrvalktpa
    ekvawlerrleeggfrllegergpwvqilqdtflevrrkkdgeeagkllqvqavlfegrl
    evvdperalatlrrgvgpgkalglgllsvap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wj9A (A:)
    mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
    vqtltepdwsvldegyaqvfppkpfhpalkpgqrlrfrlranpakrlktpaekvawlerr
    leeggfrllegergpwvqilqdtfleqvqavlfegrlevvdperalatlrrgvgpgkalg
    lgllsvap