PDB entry 1wj8

View 1wj8 on RCSB PDB site
Description: Crystal structure of a probable nucleotidyltransferase protein from Thermus Thermophilus HB8
Class: structural genomics, unknown function
Keywords: structural genomics
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-12-07, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.268
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable nucleotidyltransferase protein
    Species: Thermus thermophilus
    Domains in SCOPe 2.07: d1wj8a_
  • Chain 'B':
    Compound: probable nucleotidyltransferase protein
    Species: Thermus thermophilus
    Domains in SCOPe 2.07: d1wj8b_
  • Chain 'C':
    Compound: probable nucleotidyltransferase protein
    Species: Thermus thermophilus
    Domains in SCOPe 2.07: d1wj8c_
  • Chain 'D':
    Compound: probable nucleotidyltransferase protein
    Species: Thermus thermophilus
    Domains in SCOPe 2.07: d1wj8d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wj8A (A:)
    maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraai
    rgafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wj8A (A:)
    aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
    gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wj8B (B:)
    maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraai
    rgafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wj8B (B:)
    aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
    gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wj8C (C:)
    maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraai
    rgafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wj8C (C:)
    aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
    gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrlee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wj8D (D:)
    maslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraai
    rgafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleepa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wj8D (D:)
    aslaraverlkaalerpkdefirdsaiqrfeftfelawktlktflelqglearspraair
    gafqvgllpedpfwlemlelrnltnhtydealaeriyaelpkalerfqellrrleep