PDB entry 1wj7

View 1wj7 on RCSB PDB site
Description: Solution structure of RSGI RUH-015, a UBA domain from mouse cDNA
Class: structural genomics, unknown function
Keywords: NMR, UBA domain, ubiquitin associated domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-29, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein (RSGI RUH-015)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CRT6 (7-97)
      • cloning artifact (0-6)
      • cloning artifact (98-103)
    Domains in SCOPe 2.08: d1wj7a1, d1wj7a2, d1wj7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wj7A (A:)
    gssgssgnqnqtqhkqrpqataeqirlaqmisdhndadfeekvkqliditgknqdecvia
    lhdcngdvnrainvllegnpdthswemvgkkkgvsgqksgpssg