PDB entry 1wj6

View 1wj6 on RCSB PDB site
Description: Solution structure of RSGI RUH-024, a PB1 domain in human cDNA, KIAA0049
Class: protein binding
Keywords: NMR, PB1 domain, protein binding, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA0049 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA0049
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14596 (7-94)
    • cloning artifact (0-6)
    • cloning artifact (95-100)
  Domains in SCOPe 2.08: d1wj6a1, d1wj6a2, d1wj6a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wj6A (A:)
  gssgssgphsmepqvtlnvtfkneiqsflvsdpenttwadieamvkvsfdlntiqikyld
  eeneevsinsqgeyeealkmavkqgnqlqmqvhegsgpssg