PDB entry 1wj5

View 1wj5 on RCSB PDB site
Description: Solution structure of the hypothetical domain of RIKEN cDNA 0610009H20
Class: structural genomics, unknown function
Keywords: Winged Helix, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein (RIKEN cDNA 0610009H20)
    Species: Mus musculus [TaxId:10090]
    Gene: FANTOM 2 cDNA 0610009H20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K2X3 (7-113)
      • cloning artifact (0-6)
      • cloning artifact (114-119)
    Domains in SCOPe 2.06: d1wj5a1, d1wj5a2, d1wj5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wj5A (A:)
    gssgssgnkdnldlagltsllsekikeflqekkmqsfyqqeletveslqslasrpvthst
    gsdqvelkdsgtsgvaqrvfknalqllqekglvfqrdsgsdklyyvttkdkdlqsgpssg