PDB entry 1wj3

View 1wj3 on RCSB PDB site
Description: Solution structure of the fourth fn3 domain of KIAA1496 protein
Class: neuropeptide
Keywords: beta sandwich, PANG, KIAA1496 protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1496 protein
  Species: HOMO SAPIENS
  Gene: Kazusa cDNA fj09513
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9P232 (7-110)
    • cloning artifact (0-6)
    • cloning artifact (111-116)
  Domains in SCOP 1.73: d1wj3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wj3A (A:)
  gssgssgtvnvttkktppsqppgnvvwnatdtkvllnweqvkamenesevtgykvfyrts
  sqnnvqvlntnktsaelvlpikedyiievkattdggdgtsseqiripritssgpssg