PDB entry 1wj1

View 1wj1 on RCSB PDB site
Description: Solution structure of phosphotyrosine interaction domain of mouse Numb protein
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-28, with a file datestamp of 2004-11-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wj1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wj1A (A:)
    gssgssgasrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkatgkk
    avkavlwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwich
    cfmavkdtgerlshavgcafaaclerkqkrsgpssg