PDB entry 1wj1

View 1wj1 on RCSB PDB site
Description: Solution structure of phosphotyrosine interaction domain of mouse Numb protein
Class: signaling protein
Keywords: PTB, PID domain, Numb protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: numb protein
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1200002O22
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9QZS3 (7-149)
    • cloning artifact (0-6)
    • cloning artifact (150-155)
  Domains in SCOPe 2.08: d1wj1a1, d1wj1a2, d1wj1a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wj1A (A:)
  gssgssgasrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhicedavkrlkatgkk
  avkavlwvsadglrvvdektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwich
  cfmavkdtgerlshavgcafaaclerkqkrsgpssg