PDB entry 1wiz

View 1wiz on RCSB PDB site
Description: Solution structure of the first CUT domain of KIAA1034 protein
Class: DNA binding protein
Keywords: helix bundle, SATB2, KIAA1034 protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding protein SATB2
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA fh00753
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UPW6 (7-94)
    • cloning artifact (0-6)
    • cloning artifact (95-100)
  Domains in SCOPe 2.08: d1wiza1, d1wiza2, d1wiza3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wizA (A:)
  gssgssgkpeptnssvevspdiyqqvrdelkrasvsqavfarvafnrtqgllseilrkee
  dprtasqsllvnlramqnflnlpeverdriyqdersgpssg