PDB entry 1wix

View 1wix on RCSB PDB site
Description: The solution structure of RSGI RUH-026, conserved domain of HOOK1 protein from mouse
Class: structural genomics, unknown function
Keywords: HOOK1, structural genomics, mouse cDNA, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hook homolog 1
  Species: MUS MUSCULUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8BIL5 (7-157)
    • cloning artifact (0-6)
    • cloning artifact (158-163)
  Domains in SCOP 1.73: d1wixa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wixA (A:)
  gssgssglplcdsliiwlqtfktaspcqdvkqltngvtmaqvlhqidvawfseswlsrik
  ddvgdnwrikasnlkkvlhgitsyyheflgqqiseelipdlnqitecadpvelgrllqli
  lgcavncekkqehiknimtleesvqhvvmtaiqelmsksgpssg