PDB entry 1wix

View 1wix on RCSB PDB site
Description: The solution structure of RSGI RUH-026, conserved domain of HOOK1 protein from mouse
Class: structural genomics, unknown function
Keywords: HOOK1, structural genomics, mouse cDNA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hook homolog 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BIL5 (7-157)
      • cloning artifact (0-6)
      • cloning artifact (158-163)
    Domains in SCOPe 2.08: d1wixa1, d1wixa2, d1wixa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wixA (A:)
    gssgssglplcdsliiwlqtfktaspcqdvkqltngvtmaqvlhqidvawfseswlsrik
    ddvgdnwrikasnlkkvlhgitsyyheflgqqiseelipdlnqitecadpvelgrllqli
    lgcavncekkqehiknimtleesvqhvvmtaiqelmsksgpssg