PDB entry 1wis

View 1wis on RCSB PDB site
Description: Solution structure of the fifth FNIII domain from human KIAA1514 protein
Class: structural genomics, unknown function
Keywords: FNIII domain, KIAA1514, sidekick-2, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2005-07-19
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-19, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1514 protein
    Species: HOMO SAPIENS
    Gene: Kazusa cDNA fh00815
    Database cross-references and differences (RAF-indexed):
    • GB BAA96038 (7-117)
      • cloning artifact (0-6)
      • cloning artifact (118-123)
    Domains in SCOP 1.73: d1wisa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wisA (A:)
    gssgssgtissgvppelpgpptnlgisnigprsvtlqfrpgydgktsisrwlveaqvgvv
    gegeewllihqlsnepdarsmevpdlnpftcysfrmrqvnivgtsppsqpsrkiqtlqsg
    pssg