PDB entry 1wis

View 1wis on RCSB PDB site
Description: Solution structure of the fifth FNIII domain from human KIAA1514 protein
Class: structural genomics, unknown function
Keywords: FNIII domain, KIAA1514, sidekick-2, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2005-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1514 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA fh00815
  Database cross-references and differences (RAF-indexed):
  • GB BAA96038 (7-117)
    • cloning artifact (0-6)
    • cloning artifact (118-123)
  Domains in SCOPe 2.08: d1wisa1, d1wisa2, d1wisa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wisA (A:)
  gssgssgtissgvppelpgpptnlgisnigprsvtlqfrpgydgktsisrwlveaqvgvv
  gegeewllihqlsnepdarsmevpdlnpftcysfrmrqvnivgtsppsqpsrkiqtlqsg
  pssg