PDB entry 1wir

View 1wir on RCSB PDB site
Description: Solution structure of the C2H2 zinc finger domain of the protein arginine N-methyltransferase 3 from Mus musculus
Class: transferase
Keywords: C2H2 zinc finger domain, protein arginine N-methyltransferase 3, PRMT3, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein arginine N-methyltransferase 3
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2410018A17
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q922H1 (7-114)
    • cloning artifact (0-6)
    • cloning artifact (115-120)
  Domains in SCOPe 2.08: d1wira1, d1wira2, d1wira3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wirA (A:)
  gssgssgepahgrqhtpclfcdrlfasaeetfshcklehqfnidsmvhkhglefygyikl
  infirlknptveymnsiynpvpwekdeylkpvleddlllqfdvedlyepvstpfssgpss
  g