PDB entry 1wir

View 1wir on RCSB PDB site
Description: Solution structure of the C2H2 zinc finger domain of the protein arginine N-methyltransferase 3 from Mus musculus
Class: transferase
Keywords: C2H2 zinc finger domain, protein arginine N-methyltransferase 3, PRMT3, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein arginine N-methyltransferase 3
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2410018A17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q922H1 (7-114)
      • cloning artifact (0-6)
      • cloning artifact (115-120)
    Domains in SCOPe 2.08: d1wira1, d1wira2, d1wira3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wirA (A:)
    gssgssgepahgrqhtpclfcdrlfasaeetfshcklehqfnidsmvhkhglefygyikl
    infirlknptveymnsiynpvpwekdeylkpvleddlllqfdvedlyepvstpfssgpss
    g