PDB entry 1wiq

View 1wiq on RCSB PDB site
Description: structure of T-cell surface glycoprotein cd4, trigonal crystal form
Class: glycoprotein
Keywords: immunoglobulin fold, transmembrane, glycoprotein, T-cell, MHC lipoprotein, polymorphism
Deposited on 1996-12-18, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 5 Å
R-factor: 0.422
AEROSPACI score: -0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell surface glycoprotein cd4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wiqa1, d1wiqa2, d1wiqa3, d1wiqa4
  • Chain 'B':
    Compound: T-cell surface glycoprotein cd4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wiqb1, d1wiqb2, d1wiqb3, d1wiqb4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wiqA (A:)
    kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
    lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
    ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvlafq
    kassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsvkr
    vtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvvmratqlqkn
    ltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsgqvllesnik
    vlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wiqB (B:)
    kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
    lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
    ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvlafq
    kassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsvkr
    vtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvvmratqlqkn
    ltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsgqvllesnik
    vlp