PDB entry 1wip

View 1wip on RCSB PDB site
Description: structure of T-cell surface glycoprotein cd4, monoclinic crystal form
Class: glycoprotein
Keywords: immunoglobulin fold, transmembrane, glycoprotein, T-cell, MHC lipoprotein, polymorphism
Deposited on 1996-12-18, released 1997-07-07
The last revision prior to the SCOP 1.73 freeze date was dated 1997-07-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 4 Å
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell surface glycoprotein cd4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wipa1, d1wipa2, d1wipa3, d1wipa4
  • Chain 'B':
    Compound: T-cell surface glycoprotein cd4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wipb1, d1wipb2, d1wipb3, d1wipb4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wipA (A:)
    kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
    lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
    ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvlafq
    kassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsvkr
    vtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvvmratqlqkn
    ltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsgqvllesnik
    vlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wipB (B:)
    kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
    lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
    ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvlafq
    kassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsvkr
    vtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvvmratqlqkn
    ltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsgqvllesnik
    vlp