PDB entry 1wio

View 1wio on RCSB PDB site
Description:
Deposited on 1996-12-18, released 1997-07-07
The last revision prior to the SCOP 1.55 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 3.9 Å
R-factor: 0.24
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wioA (A:)
    kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
    lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
    ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvlafq
    kassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsvkr
    vtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvvmratqlqkn
    ltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsgqvllesnik
    vlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wioB (B:)
    kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
    lwdqgnfpliiknlkiedsdtyicevedqkeevqllvfgltansdthllqgqsltltles
    ppgsspsvqcrsprgkniqggktlsvsqlelqdsgtwtctvlqnqkkvefkidivvlafq
    kassivykkegeqvefsfplaftvekltgsgelwwqaerassskswitfdlknkevsvkr
    vtqdpklqmgkklplhltlpqalpqyagsgnltlaleaktgklhqevnlvvmratqlqkn
    ltcevwgptspklmlslklenkeakvskrekavwvlnpeagmwqcllsdsgqvllesnik
    vlp