PDB entry 1win

View 1win on RCSB PDB site
Description: Solution Structure of the Band 7 Domain of the mouse Flotillin 2 Protein
Class: cell adhesion
Keywords: Band 7 Domain, Flotillin 2, structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CELL ADHESION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flotillin 2
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1200003P16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60634 (7-136)
      • cloning artifact (0-6)
      • cloning artifact (137-142)
    Domains in SCOPe 2.08: d1wina1, d1wina2, d1wina3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1winA (A:)
    gssgssgqrisleimtlqprcedvetaegvaltvtgvaqvkimtekellavaceqflgkn
    vqdiknvvlqtleghlrsilgtltveqiyqdrdqfaklvrevaapdvgrmgieilsftik
    dvydkvdylsslgktqtsgpssg