PDB entry 1wim

View 1wim on RCSB PDB site
Description: Solution Structure of the RING finger Domain of the human UbcM4-interacting Protein 4
Class: metal binding protein
Keywords: RING finger Domain, UbcM4-interacting Protein 4, UIP4, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA0161 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA ha02800
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50876 (7-87)
    • cloning artifact (0-6)
    • cloning artifact (88-93)
  Domains in SCOPe 2.08: d1wima1, d1wima2, d1wima3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wimA (A:)
  gssgssgcklclgeypveqmttiaqcqcifctlclkqyvellikegletaiscpdaacpk
  qghlqeneiecmvaaeimqrykklqfersgpssg