PDB entry 1wil

View 1wil on RCSB PDB site
Description: Solution Structure of the RING Finger Domain of the Human KIAA1045 Protein
Class: Structural genomics, unknown function
Keywords: RING finger domain, KIAA1045 protein, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1045 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hh00656
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPV7 (7-82)
      • cloning artifact (0-6)
      • cloning artifact (83-88)
    Domains in SCOPe 2.07: d1wila1, d1wila2, d1wila3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wilA (A:)
    gssgssgprepvvndemcdvcevwtaeslfpcrvctrvfhdgclrrmgyiqgdsaaevte
    mahtetgwschycdninlllteesgpssg