PDB entry 1wij

View 1wij on RCSB PDB site
Description: Solution Structure of the DNA-Binding Domain of Ethylene-Insensitive3-Like3
Class: DNA binding protein
Keywords: DNA-binding domain, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ETHYLENE-INSENSITIVE3-like 3 protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: EIL3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1wija_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wijA (A:)
    gssgssgsqfvlqdlqdatlgsllsslmqhcdppqrkyplekgtpppwwptgneewwvkl
    glpksqsppyrkphdlkkmwkvgvltavinhmlpdiakikrhvrqskclqdkmtakesai
    wlavlnqeesliqqsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wijA (A:)
    sqfvlqdlqdatlgsllsslmqhcdppqrkyplekgtpppwwptgneewwvklglpksqs
    ppyrkphdlkkmwkvgvltavinhmlpdiakikrhvrqskclqdkmtakesaiwlavlnq
    eesliqq