PDB entry 1wij

View 1wij on RCSB PDB site
Description: solution structure of the dna-binding domain of ethylene-insensitive3- like3
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wija_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wijA (A:)
    gssgssgsqfvlqdlqdatlgsllsslmqhcdppqrkyplekgtpppwwptgneewwvkl
    glpksqsppyrkphdlkkmwkvgvltavinhmlpdiakikrhvrqskclqdkmtakesai
    wlavlnqeesliqqsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wijA (A:)
    sqfvlqdlqdatlgsllsslmqhcdppqrkyplekgtpppwwptgneewwvklglpksqs
    ppyrkphdlkkmwkvgvltavinhmlpdiakikrhvrqskclqdkmtakesaiwlavlnq
    eesliqq