PDB entry 1wig

View 1wig on RCSB PDB site
Description: Solution structure of RSGI RUH-019, a LIM domain of actin binding LIM protein 2 (KIAA1808 protein) from human cDNA
Class: Structural genomics, unknown function
Keywords: LIM DOMAIN, ZINC FINGER, METAL-BINDING PROTEIN, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1808 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: mRNA for KIAA1808 protein, partial cds.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6H8Q1 (7-66)
      • cloning artifact (0-6)
      • cloning artifact (67-72)
    Domains in SCOPe 2.07: d1wiga1, d1wiga2, d1wiga3, d1wiga4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wigA (A:)
    gssgssgcdscekyitgrvleagekhyhpscalcvrcgqmfaegeemylqgssiwhpacr
    qaartedsgpssg