PDB entry 1wie

View 1wie on RCSB PDB site
Description: Solution structure of the first SH3 domain of KIAA0318 protein
Class: protein binding
Keywords: BETA BARREL, RIM-binding protein 2, KIAA0318 protein, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RIM binding protein 2
    Species: HOMO SAPIENS
    Gene: KAZUSA cDNA hg00364
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15034 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOP 1.73: d1wiea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wieA (A:)
gssgssgtskqrysgkvhlcvarysynpfdgpnenpeaelpltagkylyvygdmdedgfy
egelldgqrglvpsnfvdfvqdnesrlastsgpssg