PDB entry 1wic

View 1wic on RCSB PDB site
Description: solution structure of the msp domain of riken cdna 6030424e15
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-28, with a file datestamp of 2004-11-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wica_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wicA (A:)
    gssgssgkkplsvfkgpllhispaeelyfgsiesgekktlivltnvtknivafkvrttap
    ekyrvkpsnsscdpgasidiivsphggltvsaqdrflimaaemeqssgtgpaelsqfwke
    vprnkvmehrlrchtvesskpnslmlsgpssg