PDB entry 1wic

View 1wic on RCSB PDB site
Description: Solution structure of the MSP domain of RIKEN cDNA 6030424E15
Class: Structural genomics, unknown function
Keywords: beta sandwich fold, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical Protein RIKEN cDNA 6030424E15
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 6030424E15
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9CWP6 (7-145)
    • cloning artifact (0-6)
    • cloning artifact (146-151)
  Domains in SCOPe 2.08: d1wica1, d1wica2, d1wica3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wicA (A:)
  gssgssgkkplsvfkgpllhispaeelyfgsiesgekktlivltnvtknivafkvrttap
  ekyrvkpsnsscdpgasidiivsphggltvsaqdrflimaaemeqssgtgpaelsqfwke
  vprnkvmehrlrchtvesskpnslmlsgpssg