PDB entry 1wi9

View 1wi9 on RCSB PDB site
Description: Solution structure of the PCI domain from mouse hypothetical protein AAH51541
Class: structural genomics, unknown function
Keywords: helix-turn-helix motif, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein C20orf116 homolog
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1110001I20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80WW9 (7-65)
      • cloning artifact (0-6)
      • cloning artifact (66-71)
    Domains in SCOPe 2.08: d1wi9a1, d1wi9a2, d1wi9a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wi9A (A:)
    gssgssgfltefinyikkskvvlledlafqmglrtqdainriqdlltegtltgviddrgk
    fiyitpsgpssg