PDB entry 1wi7

View 1wi7 on RCSB PDB site
Description: Solution structure of the SH3 domain of SH3-domain kinase binding protein 1
Class: protein binding
Keywords: BETA BARREL, Sh3kbp1, Ruk, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-28, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sh3-domain kinase binding protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 5830464D22
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R550 (7-61)
      • cloning artifact (0-6)
      • cloning artifact (62-67)
    Domains in SCOPe 2.08: d1wi7a1, d1wi7a2, d1wi7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wi7A (A:)
    gssgssgrrcqvafsylpqnddelelkvgdiievvgeveegwwegvlngktgmfpsnfik
    elsgpssg