PDB entry 1wi6

View 1wi6 on RCSB PDB site
Description: Solution structure of the RNA binding domain from mouse hypothetical protein BAB23670
Class: structural genomics, unknown function
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein (RIKEN cDNA 1300006N24)
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1300006N24
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8C3Z1 (7-81)
    • cloning artifact (0-6)
    • cloning artifact (82-87)
  Domains in SCOPe 2.08: d1wi6a1, d1wi6a2, d1wi6a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wi6A (A:)
  gssgssgilirglpgdvtnqevhdllsdyelkycfvdkykgtafvtllngeqaeaaintf
  hqsrlrerelsvqlqptdallcsgpssg