PDB entry 1wi5

View 1wi5 on RCSB PDB site
Description: Solution structure of the S1 RNA binding domain from human hypothetical protein BAA11502
Class: structural genomics, unknown function
Keywords: S1 domain, OB-fold, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RRP5 protein homolog
    Species: HOMO SAPIENS
    Gene: RIKEN cDNA ha02717
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14690 (7-112)
      • cloning artifact (0-6)
      • cloning artifact (113-118)
    Domains in SCOP 1.75: d1wi5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wi5A (A:)
    gssgssgknvnrvlsaealkpgmlltgtvssledhgylvdigvdgtraflpllkaqeyir
    qknkgaklkvgqylncivekvkgnggvvslsvghsevstaiateqqswnlnnlsgpssg