PDB entry 1wi4

View 1wi4 on RCSB PDB site
Description: Solution structure of the PDZ domain of syntaxin binding protein 4
Class: protein binding
Keywords: syntaxin4-interacting protein, synip, Stxbp4 protein, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2004-05-28, released 2005-06-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: syntaxin binding protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2700027C09
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WV89 (7-102)
      • cloning artifact (0-6)
      • cloning artifact (103-108)
    Domains in SCOPe 2.02: d1wi4a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wi4A (A:)
    gssgssgspldrdpafrvitvtketglglkilgginrnegplvyihevipggdcykdgrl
    kpgdqlvsinkesmigvsfeeaksiitraklrsespweiafirsgpssg