PDB entry 1wi4

View 1wi4 on RCSB PDB site
Description: Solution structure of the PDZ domain of syntaxin binding protein 4
Class: protein binding
Keywords: syntaxin4-interacting protein, synip, Stxbp4 protein, STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2005-06-07
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-07, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: syntaxin binding protein 4
  Species: MUS MUSCULUS
  Gene: RIKEN cDNA 2700027C09
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WV89 (7-102)
    • cloning artifact (0-6)
    • cloning artifact (103-108)
  Domains in SCOP 1.73: d1wi4a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wi4A (A:)
  gssgssgspldrdpafrvitvtketglglkilgginrnegplvyihevipggdcykdgrl
  kpgdqlvsinkesmigvsfeeaksiitraklrsespweiafirsgpssg